PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Itr_sc000543.1_g00010.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Convolvulaceae; Ipomoeeae; Ipomoea
Family NAC
Protein Properties Length: 337aa    MW: 37582.1 Da    PI: 8.3998
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Itr_sc000543.1_g00010.1genomeKazusaView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM169.11.4e-52141391128
                      NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkat 86 
                              lppGfrF Ptdeel+v+yL++kv+g++++l ++i ++d+yk++PwdLp++++ +ekewyfFs+rd+ky++g+r+nr++ +gyWkat
  Itr_sc000543.1_g00010.1  14 LPPGFRFYPTDEELLVQYLCRKVAGHDFSL-QIIGDIDLYKFDPWDLPSRANFGEKEWYFFSPRDRKYPNGSRPNRVAGTGYWKAT 98 
                              79***************************9.89***************99999********************************* PP

                      NAM  87 gkdkevlskkgelvglkktLvfykgrapkgektdWvmheyrl 128
                              g+dk +++ +g++vg+kk Lvfy g+apkg+kt+W+mheyrl
  Itr_sc000543.1_g00010.1  99 GTDKIITT-EGRKVGIKKALVFYVGKAPKGTKTNWIMHEYRL 139
                              ****9999.999****************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019411.57E-659163IPR003441NAC domain
PROSITE profilePS5100560.50314162IPR003441NAC domain
PfamPF023655.2E-2615139IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009414Biological Processresponse to water deprivation
GO:0009737Biological Processresponse to abscisic acid
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 337 aa     Download sequence    Send to blast
MGVKDMDPLS QLSLPPGFRF YPTDEELLVQ YLCRKVAGHD FSLQIIGDID LYKFDPWDLP  60
SRANFGEKEW YFFSPRDRKY PNGSRPNRVA GTGYWKATGT DKIITTEGRK VGIKKALVFY  120
VGKAPKGTKT NWIMHEYRLC EAPRKTGSAR LDEWVLCRIY KKNSSAAAAG AQKPVSGVQS  180
KDYSHGSSSS SSSQFDDMLE SLPEINDQYF SLPRINSLKN LNLQQDDKSS ILRLNSGSFD  240
WATLAGINSI PELGPGNQIP QSGHLNHANP ADIYGGHSMA LSFPVDDEAQ SGIRVENNSG  300
IYQPQNPNAF THNFSNLLDP YGIRYANQPG SLAFRQQ
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A1e-10411664169NO APICAL MERISTEM PROTEIN
1ut4_B1e-10411664169NO APICAL MERISTEM PROTEIN
1ut7_A1e-10411664169NO APICAL MERISTEM PROTEIN
1ut7_B1e-10411664169NO APICAL MERISTEM PROTEIN
4dul_A1e-10411664169NAC domain-containing protein 19
4dul_B1e-10411664169NAC domain-containing protein 19
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011095243.11e-165PREDICTED: NAC domain-containing protein 72-like
SwissprotQ93VY31e-132NAC72_ARATH; NAC domain-containing protein 72
TrEMBLA0A068UCE61e-159A0A068UCE6_COFCA; Uncharacterized protein
STRINGPGSC0003DMT4000496651e-152(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA31222452
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G27410.21e-132NAC family protein